PDB entry 1xwh

View 1xwh on RCSB PDB site
Description: NMR structure of the first phd finger of autoimmune regulator protein (AIRE1): insights into apeced
Class: transcription
Keywords: PHD domain, Zn binding domain, APECED, nucleosome, E3 ligase, TRANSCRIPTION
Deposited on 2004-11-01, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoimmune regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: aire1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43918 (4-65)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d1xwha1, d1xwha2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwhA (A:)
    gamaqknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqev
    qpraee