PDB entry 1xwf

View 1xwf on RCSB PDB site
Description: K185N mutated S-adenosylhomocysteine hydrolase
Class: hydrolase
Keywords: S-Adenosylhomocysteine hydrolase, AdoHcy hydrolase, AdoHcyase, SAHH
Deposited on 2004-11-01, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ahcy
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (184)
    Domains in SCOPe 2.06: d1xwfa1, d1xwfa2
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ahcy
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (184)
    Domains in SCOPe 2.06: d1xwfb1, d1xwfb2
  • Chain 'C':
    Compound: Adenosylhomocysteinase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ahcy
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (184)
    Domains in SCOPe 2.06: d1xwfc1, d1xwfc2
  • Chain 'D':
    Compound: Adenosylhomocysteinase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ahcy
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (184)
    Domains in SCOPe 2.06: d1xwfd1, d1xwfd2
  • Heterogens: NAD, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwfA (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwfA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwfB (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwfB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwfC (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwfC (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwfD (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwfD (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtnskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry