PDB entry 1xwe

View 1xwe on RCSB PDB site
Description: NMR Structure of C345C (NTR) domain of C5 of complement
Class: signaling protein
Keywords: OB fiold, SIGNALING PROTEIN
Deposited on 2004-10-30, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Gene: C5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01031 (4-150)
      • cloning artifact (0-3)
      • engineered (105)
    Domains in SCOPe 2.07: d1xwea1, d1xwea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xweA (A:)
    gshmadcgqmqeeldltisaetrkqtackpeiayaykvsitsitvenvfvkykatlldiy
    ktgeavaekdseitfikkvtctnaelvkgrqylimgkealqikynasfryiypldsltwi
    eywprdttcsscqaflanldefaediflngc