PDB entry 1xwd

View 1xwd on RCSB PDB site
Description: Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
Class: Hormone/Growth Factor
Keywords: Hormone-receptor complex, Leucine-rich repeats, Cysteine-knot motif, Hormone-Growth Factor COMPLEX
Deposited on 2004-10-30, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein hormones alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: CGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwda_
  • Chain 'B':
    Compound: Follitropin beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FSHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwdb1
  • Chain 'C':
    Compound: Follicle stimulating hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FSHR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwdc1
  • Chain 'D':
    Compound: Glycoprotein hormones alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: CGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwdd_
  • Chain 'E':
    Compound: Follitropin beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FSHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwde_
  • Chain 'F':
    Compound: Follicle stimulating hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FSHR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwdf_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwdA (A:)
    apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdA (A:)
    dvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccva
    ksynrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xwdB (B:)
    nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
    vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfgemke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdB (B:)
    celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
    vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xwdC (C:)
    gchhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekie
    isqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlp
    dvhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqld
    elnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklp
    tleklvalmeas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdC (C:)
    chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei
    sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd
    vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde
    lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklpt
    le
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xwdD (D:)
    apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdD (D:)
    dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
    nrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xwdE (E:)
    nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
    vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfgemke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdE (E:)
    celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
    vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xwdF (F:)
    gchhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekie
    isqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlp
    dvhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqld
    elnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarstynlkklp
    tleklvalmeas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwdF (F:)
    chhrichcsnrvflcqeskvteipsdlprnaielrfvltklrviqkgafsgfgdlekiei
    sqndvlevieadvfsnlpklheiriekannllyinpeafqnlpnlqyllisntgikhlpd
    vhkihslqkvlldiqdninihtiernsfvglsfesvilwlnkngiqeihncafngtqlde
    lnlsdnnnleelpndvfhgasgpvildisrtrihslpsyglenlkklrarsty