PDB entry 1xwc

View 1xwc on RCSB PDB site
Description: Drosophila thioredoxin, reduced, P6522
Class: electron transport
Keywords: Dimerization, Drosophila melanogaster, redox regulation, thioredoxin, x-ray crystal structure
Deposited on 2004-10-29, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Drosophila melanogaster
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwcA (A:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani