PDB entry 1xwb

View 1xwb on RCSB PDB site
Description: Drospohila thioredoxin, oxidized, P42212
Class: electron transport
Keywords: Dimerization, Drosophila melanogaster, redox regulation, thioredoxin, x-ray crystal structure
Deposited on 2004-10-29, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Drosophila melanogaster
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwba_
  • Chain 'B':
    Compound: thioredoxin
    Species: Drosophila melanogaster
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwbb_
  • Chain 'C':
    Compound: thioredoxin
    Species: Drosophila melanogaster
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwbc_
  • Chain 'D':
    Compound: thioredoxin
    Species: Drosophila melanogaster
    Gene: TRX-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xwbd_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwbA (A:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwbB (B:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwbC (C:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xwbD (D:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani