PDB entry 1xw9

View 1xw9 on RCSB PDB site
Description: Drosophila thioredoxin, oxidized, P21
Class: electron transport
Keywords: Dimerization, Drosophila melanogaster, redox regulation, thioredoxin, x-ray crystal structure, ELECTRON TRANSPORT
Deposited on 2004-10-29, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xw9a_
  • Chain 'B':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xw9b_
  • Chain 'C':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xw9c_
  • Chain 'D':
    Compound: thioredoxin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xw9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw9A (A:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw9B (B:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw9C (C:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw9D (D:)
    mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
    decediameynissmptfvflkngvkveefaganakrledvikani