PDB entry 1xw8

View 1xw8 on RCSB PDB site
Description: X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
Deposited on 2004-10-29, released 2004-11-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xw8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xw8A (A:)
    mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
    pdrenfgrsamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqla
    daiaravyacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgal
    ieneeqalaqtlemvqhgrvksitgewatvaaqtvclhgdgehalafarrlrsafaekgi
    vvaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw8A (A:)
    mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
    psamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqladaiarav
    yacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgeeqalaqtl
    emvqhgrvksitgewatvaaqtvclhgdghalafarrlrsafivvaaleh