PDB entry 1xw8

View 1xw8 on RCSB PDB site
Description: X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
Class: structural genomics, unknown function
Keywords: NESG, Northeast Structural Genomics Consortium, Structural Genomics, Protein Structure Initiative, PSI, crystal structure, X-Ray, UNKNOWN FUNCTION
Deposited on 2004-10-29, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0271 protein ybgL
    Species: Escherichia coli [TaxId:562]
    Gene: ybgL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75746 (0-243)
      • modified residue (0)
      • modified residue (39)
      • modified residue (70)
      • modified residue (99)
      • modified residue (107)
      • modified residue (193)
      • expression tag (244-246)
    Domains in SCOPe 2.08: d1xw8a1, d1xw8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xw8A (A:)
    mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
    pdrenfgrsamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqla
    daiaravyacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgal
    ieneeqalaqtlemvqhgrvksitgewatvaaqtvclhgdgehalafarrlrsafaekgi
    vvaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw8A (A:)
    mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsf
    psamqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqladaiarav
    yacdpalilvglagseliragkqyglttreevfadrgyqadgslvprsqsgeeqalaqtl
    emvqhgrvksitgewatvaaqtvclhgdghalafarrlrsafivvaaleh