PDB entry 1xw7

View 1xw7 on RCSB PDB site
Description: diabetes-associated mutations in human insulin: crystal structure and photo-cross-linking studies of a-chain variant insulin wakayama
Deposited on 2004-10-29, released 2005-04-12
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered (2)
  • Chain 'B':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered (2)
  • Chain 'D':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPH, ZN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xw7A (A:)
    gileqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1xw7B (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1xw7C (C:)
    gileqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1xw7D (D:)
    fvnqhlcgshlvealylvcgergffytpkt