PDB entry 1xw5

View 1xw5 on RCSB PDB site
Description: Human glutathione s-transferase M2-2 (E.C.2.5.1.18)complexed with glutathione, monoclinic crystal form
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site
Deposited on 2004-10-29, released 2004-11-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xw5a1, d1xw5a2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xw5b1, d1xw5b2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw5A (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw5B (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk