PDB entry 1xw3

View 1xw3 on RCSB PDB site
Description: Crystal Structure of Human Sulfiredoxin (Srx)
Class: oxidoreductase
Keywords: retroreduction, sulfinic acid, peroxiredoxin, ATP, OXIDOREDUCTASE
Deposited on 2004-10-29, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.216
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfiredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYN0 (4-109)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1xw3a1, d1xw3a2
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xw3A (A:)
    gphmsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikga
    qggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq