PDB entry 1xw2

View 1xw2 on RCSB PDB site
Description: Structure Of A Cold-Adapted Family 8 Xylanase
Class: hydrolase
Keywords: hydrolase, xylan degradation, psychrophilic, cold adaptation, temperature, glycosyl hydrolase, family 8
Deposited on 2004-10-29, released 2005-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.161
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RJN8 (0-End)
      • engineered (77)
    Domains in SCOPe 2.06: d1xw2a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xw2A (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtqgqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw2A (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtqgqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf