PDB entry 1xvx

View 1xvx on RCSB PDB site
Description: Crystal Structure of iron-loaded Yersinia enterocolitica YfuA
Class: iron binding protein
Keywords: periplasmic iron binding protein, iron binding protein
Deposited on 2004-10-28, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.163
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YfuA
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yfuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56925 (Start-311)
      • see remark 999 (4)
      • see remark 999 (92)
      • see remark 999 (116)
      • see remark 999 (120)
    Domains in SCOPe 2.07: d1xvxa_
  • Heterogens: FE, ZN, CO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvxA (A:)
    esndsgivvynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvfl
    tenspamvlvdnaklfapldavtqaqvaqeyrpehgrwtgiaarstvfvynpekiseael
    pksimdlakpewkgrwaaspsgadfqaivsamlelkgekatlewlkamktnftaykgnst
    vmkavnagqidggviyhyyrfvdqaktgensgktqlhyfkhqdpgafvsisgggvlassk
    hpkeaqefvkwitgksgqdilrtnnafeyavgvdaasnpklvplkdldapkvepsklnsk
    kvvelmteagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvxA (A:)
    sndsgivvynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvflt
    enspamvlvdnaklfapldavtqaqvaqeyrpehgrwtgiaarstvfvynpekiseaelp
    ksimdlakpewkgrwaaspsgadfqaivsamlelkgekatlewlkamktnftaykgnstv
    mkavnagqidggviyhyyrfvdqaktgensgktqlhyfkhqdpgafvsisgggvlasskh
    pkeaqefvkwitgksgqdilrtnnafeyavgvdaasnpklvplkdldapkvepsklnskk
    vvelmteagll