PDB entry 1xvw

View 1xvw on RCSB PDB site
Description: Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys peroxiredoxin
Class: oxidoreductase
Keywords: thioredoxin fold, Oxidized cystein sulfenic acid, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2004-10-28, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65688 (7-159)
      • cloning artifact (2-6)
      • modified residue (51)
    Domains in SCOPe 2.08: d1xvwa1, d1xvwa2
  • Chain 'B':
    Compound: Hypothetical protein Rv2238c/MT2298
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rv2238c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65688 (7-159)
      • cloning artifact (0-6)
      • modified residue (51)
    Domains in SCOPe 2.08: d1xvwb2, d1xvwb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvwA (A:)
    kvprgshmlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlr
    dhlpefenddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagi
    anrgtfvvdrsgiirfaemkqpgevrdqrlwtdalaalta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvwA (A:)
    prgshmlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdh
    lpefenddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagian
    rgtfvvdrsgiirfaemkqpgevrdqrlwtdalaalta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvwB (B:)
    kvprgshmlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlr
    dhlpefenddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagi
    anrgtfvvdrsgiirfaemkqpgevrdqrlwtdalaalta