PDB entry 1xvv

View 1xvv on RCSB PDB site
Description: Crystal Structure of CaiB mutant D169A in complex with carnitinyl-CoA
Class: transferase
Keywords: CaiB, CoA-transferase, Carnityl-CoA, Asp mutant, TRANSFERASE
Deposited on 2004-10-28, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572 (Start-407)
      • engineered (171)
    Domains in SCOPe 2.08: d1xvva_
  • Heterogens: CCQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvvA (A:)
    gshmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpn
    ypqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpk
    lviahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytaayfsgltat
    taalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcg
    lykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekld
    awlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnim
    pkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvvA (A:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytaayfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakved