PDB entry 1xvt

View 1xvt on RCSB PDB site
Description: Crystal Structure of Native CaiB in complex with coenzyme A
Class: transferase
Keywords: CaiB, CoA transferase, Carnitine, Crotonobetainyl coA, TRANSFERASE
Deposited on 2004-10-28, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572 (Start-407)
      • modified residue (8)
      • modified residue (34)
      • modified residue (88)
      • modified residue (163)
      • modified residue (202)
      • modified residue (206)
      • modified residue (209)
      • modified residue (214-215)
      • modified residue (223)
      • modified residue (227)
      • modified residue (250)
      • modified residue (348)
      • modified residue (359)
      • modified residue (373)
      • modified residue (378)
    Domains in SCOPe 2.08: d1xvta_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvtA (A:)
    gshmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpn
    ypqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpk
    lviahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltat
    taalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcg
    lykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekld
    awlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnim
    pkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvtA (A:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakved