PDB entry 1xvq

View 1xvq on RCSB PDB site
Description: Crystal structure of thiol peroxidase from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: thioredoxin fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2004-10-28, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol Peroxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: TPX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66952 (Start-164)
      • modified residue (79)
      • cloning artifact (165-166)
    Domains in SCOPe 2.07: d1xvqa1, d1xvqa2
  • Heterogens: YT3, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvqA (A:)
    maqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvc
    atsvrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtia
    dgpmagllaraivvigadgnvaytelvpeiaqepnyeaalaalgatsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvqA (A:)
    aqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvca
    tsvrtfderaaasgatvlcvskdlpfaqkrfcnvmpasafrdsfgedygvtiadgpmagl
    laraivvigadgnvaytelvpeiaqepnyeaalaalgats