PDB entry 1xvp

View 1xvp on RCSB PDB site
Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid and citco
Deposited on 2004-10-28, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xvpa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xvpb_
  • Chain 'C':
    Domains in SCOP 1.71: d1xvpc_
  • Chain 'D':
    Domains in SCOP 1.71: d1xvpd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvpA (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvpA (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvpB (B:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvpC (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvpD (D:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics