PDB entry 1xvo

View 1xvo on RCSB PDB site
Description: Trypsin from Fusarium oxysporum at pH 6
Class: hydrolase
Keywords: trypsin, atomic resolution, HYDROLASE
Deposited on 2004-10-28, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.84 Å
R-factor: 0.108
AEROSPACI score: 1.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvoa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvoA (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya