PDB entry 1xvm

View 1xvm on RCSB PDB site
Description: Trypsin from Fusarium oxysporum- room temperature to atomic resolution
Class: hydrolase
Keywords: atomic resolution, mobility, room temperature, HYDROLASE
Deposited on 2004-10-28, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.144
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvma_
  • Chain 'B':
    Compound: substrate tripeptide GLY-ALA-ARG
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XVM (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xvmA (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
    

  • Chain 'B':
    No sequence available.