PDB entry 1xvl

View 1xvl on RCSB PDB site
Description: The three-dimensional structure of MntC from Synechocystis 6803
Class: metal transport
Keywords: manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, METAL TRANSPORT
Deposited on 2004-10-28, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mn transporter
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: mntC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvla1
  • Chain 'B':
    Compound: Mn transporter
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: mntC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvlb_
  • Chain 'C':
    Compound: Mn transporter
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: mntC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvlc_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvlA (A:)
    mtstrlqklrirapgcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvq
    nvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvp
    svvltegiepipiadgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaa
    vyseqlkaidrqlgadleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpk
    qvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfld
    lleydarvitngllagtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvlA (A:)
    geteekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlil
    yngmnlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyven
    irqafveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylar
    dygmeeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarf
    ggnlyvdslsteegpvptfldlleydarvitngllagtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xvlB (B:)
    mtstrlqklrirapgcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvq
    nvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvp
    svvltegiepipiadgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaa
    vyseqlkaidrqlgadleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpk
    qvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfld
    lleydarvitngllagtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvlB (B:)
    ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
    nlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirqa
    fveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygm
    eeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnl
    yvdslsteegpvptfldlleydarvitngll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xvlC (C:)
    mtstrlqklrirapgcgtaevttsnapseevtavttevqgeteekkkvlttftvladmvq
    nvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngmnlerwfeqflgnvkdvp
    svvltegiepipiadgpytdkpnphawmsprnalvyvenirqafveldpdnakyynanaa
    vyseqlkaidrqlgadleqvpanqrflvscegafsylardygmeeiymwpinaeqqftpk
    qvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnlyvdslsteegpvptfld
    lleydarvitngllagtnaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvlC (C:)
    eekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyng
    mnlerwfeqflgnvkdvpsvvltegiepipiaddkpnphawmsprnalvyvenirqafve
    ldpdnakyynanaavyseqlkaidcegafsylardywpinaeqqftpkqvqtvieevktn
    nvptifcestvsdknlyvdslsteegpvptfldlley