PDB entry 1xvj

View 1xvj on RCSB PDB site
Description: Crystal Structure Of Rat alpha-Parvalbumin D94S/G98E Mutant
Class: metal binding protein
Keywords: parvalbumin, calcium-binding protein, EF hand protein, METAL BINDING PROTEIN
Deposited on 2004-10-28, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parvalbumin alpha
  Species: Rattus norvegicus [TaxId:10116]
  Gene: PVALB, PVA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02625 (0-108)
    • engineered (93)
    • engineered (97)
  Domains in SCOPe 2.07: d1xvja_
• Chain 'B':
  Compound: parvalbumin alpha
  Species: Rattus norvegicus [TaxId:10116]
  Gene: PVALB, PVA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02625 (0-108)
    • engineered (93)
    • engineered (97)
  Domains in SCOPe 2.07: d1xvjb_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xvjA (A:)
  smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
  delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xvjB (B:)
  smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
  delgsilkgfssdardlsaketktlmaagdkdgsgkieveefstlvaes