PDB entry 1xvi

View 1xvi on RCSB PDB site
Description: Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12
Class: hydrolase
Keywords: hypothetical protein, conserved protein, phophatase-like domain, predicted hydrolase, Sucrose-6F-phosphate phosphohydrolase (S6PP), structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics
Deposited on 2004-10-28, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mannosyl-3-phosphoglycerate phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: yedP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvia_
  • Chain 'B':
    Compound: Putative mannosyl-3-phosphoglycerate phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: yedP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xvib_
  • Heterogens: SO4, 1PE, PG4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xviA (A:)
    ghmfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylq
    ktlglqglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttf
    ddvddatiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarf
    whvldasagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkglnreg
    vhlhdedparvwrtqregpegwregldhffsargs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xviA (A:)
    iqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqktlgl
    qglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfddvdd
    atiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwhvld
    asagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xviB (B:)
    ghmfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylq
    ktlglqglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttf
    ddvddatiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarf
    whvldasagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkglnreg
    vhlhdedparvwrtqregpegwregldhffsargs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xviB (B:)
    mfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqkt
    lglqglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfdd
    vddatiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwh
    vldasagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgl