PDB entry 1xvh

View 1xvh on RCSB PDB site
Description: Crystal structure of the Staphylococcus aureus protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB.
Class: cell adhesion
Keywords: adhesin, MCSG, Midwest Center for Structural Genomics, protein structure initiative, PSI, CELL ADHESION
Deposited on 2004-10-27, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein, similar to streptococcal adhesin emb
    Species: Staphylococcus aureus [TaxId:196620]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NWQ6 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • cloning artifact (97)
      • cloning artifact (120)
    Domains in SCOPe 2.07: d1xvha3, d1xvha4, d1xvha5
  • Chain 'B':
    Compound: hypothetical protein, similar to streptococcal adhesin emb
    Species: Staphylococcus aureus [TaxId:196620]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NWQ6 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • cloning artifact (97)
      • cloning artifact (120)
    Domains in SCOPe 2.07: d1xvhb3, d1xvhb4, d1xvhb5
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvhA (A:)
    tstmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnkqtgpntaktaveq
    alnnvnnakhalngtqnlnnakqaaitaingasdlnqkqkdalkaqangaqrvsnaqdvq
    hnatelnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvhA (A:)
    tmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilntaktaveqalnnvnna
    khalngtqnlnnakqaaitaingasdlnqkqkdalkaqangaqrvsnaqdvqhnatelnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xvhB (B:)
    tstmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnkqtgpntaktaveq
    alnnvnnakhalngtqnlnnakqaaitaingasdlnqkqkdalkaqangaqrvsnaqdvq
    hnatelnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvhB (B:)
    tmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilaktaveqalnnvnnakh
    alngtqnlnnakqaaitaingasdlnqkqkdalkaqangaqrvsnaqdvqhnatelnt