PDB entry 1xv9

View 1xv9 on RCSB PDB site
Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid, and 5b-pregnane-3,20-dione.
Deposited on 2004-10-27, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xv9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xv9b_
  • Chain 'C':
    Domains in SCOP 1.71: d1xv9c_
  • Chain 'D':
    Domains in SCOP 1.71: d1xv9d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xv9A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv9A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xv9B (B:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xv9C (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv9C (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xv9D (D:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics