PDB entry 1xv9

View 1xv9 on RCSB PDB site
Description: crystal structure of CAR/RXR heterodimer bound with SRC1 peptide, fatty acid, and 5b-pregnane-3,20-dione.
Class: DNA binding protein
Keywords: CAR, RXR, SRC1, pregnanedione, DNA BINDING PROTEIN
Deposited on 2004-10-27, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xv9a_
  • Chain 'B':
    Compound: Orphan nuclear receptor NR1I3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xv9b_
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xv9c_
  • Chain 'D':
    Compound: Orphan nuclear receptor NR1I3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xv9d_
  • Chain 'E':
    Compound: nuclear receptor coactivator 1 isoform 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_003734
  • Chain 'F':
    Compound: nuclear receptor coactivator 1 isoform 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_003734 (Start-12)
  • Chain 'G':
    Compound: nuclear receptor coactivator 1 isoform 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_003734
  • Chain 'H':
    Compound: nuclear receptor coactivator 1 isoform 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_003734 (0-End)
  • Heterogens: CI2, F15, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xv9A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv9A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xv9B (B:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xv9C (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv9C (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xv9D (D:)
    pvqlskeqeelirtllgahtrhmgtmfeqfvqfrppahlfihhqplptlapvlplvthfa
    dintfmvlqvikftkdlpvfrslpiedqisllkgaaveichivlnttfclqtqnflcgpl
    rytiedgarvgfqveflellfhfhgtlrklqlqepeyvllaamalfspdrpgvtqrdeid
    qlqeemaltlqsyikgqqrrprdrflyakllgllaelrsineaygyqiqhiqglsammpl
    lqeics
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.