PDB entry 1xv5

View 1xv5 on RCSB PDB site
Description: alpha-glucosyltransferase (AGT) in complex with UDP
Deposited on 2004-10-27, released 2005-08-30
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (1-400)
      • cloning artifact (0)
      • modified residue (14)
      • modified residue (274)
  • Heterogens: CL, UDP, EDO, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xv5A (A:)
    smricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsipv
    ilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsvl
    slrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqppmd
    ivkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglerspa
    fiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnqk
    ylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestfer
    ikelssdralydrerekayeflyqhqdssfcfkeqfdiitk