PDB entry 1xv3

View 1xv3 on RCSB PDB site
Description: NMR structure of the synthetic penaeidin 4
Deposited on 2004-10-27, released 2005-02-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penaeidin-4d
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xv3A (A:)
    hssgytrplrkpsrpifirpigcdvcygipsstarlccfrygdcchl