PDB entry 1xv2

View 1xv2 on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function Similar to Alpha-acetolactate Decarboxylase from Staphylococcus aureus
Class: structural genomics, unknown function
Keywords: alpha-acetolactate, Staphylococcus aureus, structural genomics, MCSG, Midwest Center for Structural Genomics, PSI, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2004-10-26, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein, similar to alpha-acetolactate decarboxylase
    Species: Staphylococcus aureus [TaxId:46170]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A3A7 (Start-236)
      • modified residue (17)
      • modified residue (105)
      • modified residue (123)
      • modified residue (127-128)
    Domains in SCOPe 2.07: d1xv2a_
  • Chain 'B':
    Compound: hypothetical protein, similar to alpha-acetolactate decarboxylase
    Species: Staphylococcus aureus [TaxId:46170]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A3A7 (Start-236)
      • modified residue (17)
      • modified residue (105)
      • modified residue (123)
      • modified residue (127-128)
    Domains in SCOPe 2.07: d1xv2b_
  • Chain 'C':
    Compound: hypothetical protein, similar to alpha-acetolactate decarboxylase
    Species: Staphylococcus aureus [TaxId:46170]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A3A7 (Start-236)
      • modified residue (17)
      • modified residue (105)
      • modified residue (123)
      • modified residue (127-128)
    Domains in SCOPe 2.07: d1xv2c_
  • Chain 'D':
    Compound: hypothetical protein, similar to alpha-acetolactate decarboxylase
    Species: Staphylococcus aureus [TaxId:46170]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A3A7 (Start-236)
      • modified residue (17)
      • modified residue (105)
      • modified residue (123)
      • modified residue (127-128)
    Domains in SCOPe 2.07: d1xv2d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xv2A (A:)
    snamtnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhan
    ehkefielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygt
    fkhmhvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfa
    dderaygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv2A (A:)
    nvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehkef
    ielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhmh
    vrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfaddera
    ygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xv2B (B:)
    snamtnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhan
    ehkefielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygt
    fkhmhvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfa
    dderaygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv2B (B:)
    nvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehkef
    ielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhmh
    vrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfaddera
    ygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xv2C (C:)
    snamtnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhan
    ehkefielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygt
    fkhmhvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfa
    dderaygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv2C (C:)
    tnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehke
    fielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhm
    hvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfadder
    aygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xv2D (D:)
    snamtnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhan
    ehkefielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygt
    fkhmhvrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfa
    dderaygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv2D (D:)
    nvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehkef
    ielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhmh
    vrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfaddera
    ygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae