PDB entry 1xv1

View 1xv1 on RCSB PDB site
Description: Human sulfotransferase SULT1B1 in complex with PAP
Class: transferase
Keywords: SULT, sulfotransferase, PAP, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2004-10-26, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfotransferase
    Species: HOMO SAPIENS
    Gene: SULT1B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xv1a_
  • Chain 'B':
    Compound: sulfotransferase
    Species: HOMO SAPIENS
    Gene: SULT1B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xv1b_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xv1A (A:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv1A (A:)
    pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
    dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
    ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkk
    keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
    lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xv1B (B:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xv1B (B:)
    pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
    dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
    ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkk
    keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
    lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei