PDB entry 1xuz

View 1xuz on RCSB PDB site
Description: Crystal structure analysis of sialic acid synthase (NeuB)from Neisseria meningitidis, bound to Mn2+, Phosphoenolpyruvate, and N-acetyl mannosaminitol
Class: biosynthetic protein
Keywords: TIM barrel, Antifreeze-like domain, Domain-swapped dimer, BIOSYNTHETIC PROTEIN
Deposited on 2004-10-26, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polysialic acid capsule biosynthesis protein SiaC
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xuza1, d1xuza2
  • Heterogens: MMN, MN, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xuzA (A:)
    mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
    demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
    qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
    hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
    mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdik
    kgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuzA (A:)
    qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
    emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
    rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
    ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
    drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdikk
    gellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie