PDB entry 1xuv

View 1xuv on RCSB PDB site
Description: X-Ray Crystal Structure of Protein MM0500 from Methanosarcina mazei. Northeast Structural Genomics Consortium Target MaR10.
Class: structural genomics, unknown function
Keywords: Alpha-beta protein, Northeast Structural Genomics Consortium, NESG, Structural Genomics, Protein Structure Initiative, PSI, UNKNOWN FUNCTION
Deposited on 2004-10-26, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein MM0500
    Species: Methanosarcina mazei [TaxId:192952]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PZJ2 (Start-169)
      • modified residue (144)
      • modified residue (149)
      • modified residue (167)
      • expression tag (170-172)
    Domains in SCOPe 2.07: d1xuva1, d1xuva2
  • Chain 'B':
    Compound: hypothetical protein MM0500
    Species: Methanosarcina mazei [TaxId:192952]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PZJ2 (Start-169)
      • modified residue (144)
      • modified residue (149)
      • modified residue (167)
      • expression tag (170-172)
    Domains in SCOPe 2.07: d1xuvb1, d1xuvb2
  • Chain 'C':
    Compound: hypothetical protein MM0500
    Species: Methanosarcina mazei [TaxId:192952]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PZJ2 (Start-169)
      • modified residue (144)
      • modified residue (149)
      • modified residue (167)
      • expression tag (170-172)
    Domains in SCOPe 2.07: d1xuvc1, d1xuvc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xuvA (A:)
    mkgygemaknnptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttal
    kifepknggswqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarf
    ealpgdrtkltshsvfqtiedrdgmlqsgmeegindsyerldellekmkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuvA (A:)
    nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
    wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
    tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xuvB (B:)
    mkgygemaknnptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttal
    kifepknggswqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarf
    ealpgdrtkltshsvfqtiedrdgmlqsgmeegindsyerldellekmkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuvB (B:)
    nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
    wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
    tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xuvC (C:)
    mkgygemaknnptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttal
    kifepknggswqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarf
    ealpgdrtkltshsvfqtiedrdgmlqsgmeegindsyerldellekmkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuvC (C:)
    nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
    wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
    tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh