PDB entry 1xut

View 1xut on RCSB PDB site
Description: Solution structure of TACI-CRD2
Class: CYTOKINE Receptor
Keywords: TNF Receptor,cytokine, cysteine-rich domain,receptor, CYTOKINE Receptor
Deposited on 2004-10-26, released 2004-11-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor necrosis factor receptor superfamily member 13B
  Species: Homo sapiens [TaxId:9606]
  Gene: TNFRSF13B, TACI
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14836 (4-45)
    • cloning artifact (0-3)
  Domains in SCOPe 2.05: d1xuta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xutA (A:)
  gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr