PDB entry 1xut

View 1xut on RCSB PDB site
Description: Solution structure of TACI-CRD2
Class: CYTOKINE Receptor
Keywords: TNF Receptor,cytokine, cysteine-rich domain,receptor
Deposited on 2004-10-26, released 2004-11-09
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 13B
    Species: HOMO SAPIENS
    Gene: TNFRSF13B, TACI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14836 (4-45)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d1xuta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xutA (A:)
    gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr