PDB entry 1xup

View 1xup on RCSB PDB site
Description: enterococcus casseliflavus glycerol kinase complexed with glycerol
Class: transferase
Keywords: transferase
Deposited on 2004-10-26, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glycerol kinase
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xupo1, d1xupo2
  • Chain 'X':
    Compound: glycerol kinase
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xupx1, d1xupx2
  • Heterogens: GOL

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xupO (O:)
    yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf
    iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi
    hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys
    nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag
    dqqaalfgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyaleg
    sifvagsaiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargav
    fgltrgttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqad
    ildidvqraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlye
    gwkqava
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xupX (X:)
    yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf
    iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi
    hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys
    nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag
    dqqaalfgqmafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyaleg
    sifvagsaiqwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargav
    fgltrgttkedfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqad
    ildidvqraanlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlye
    gwkqava