PDB entry 1xub

View 1xub on RCSB PDB site
Description: Structure and function of the phenazine biosynthetic protein PhzF from Pseudomonas fluorescens
Class: biosynthetic protein
Keywords: phenazine biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2004-10-26, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.135
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51792 (20-297)
      • engineered (93)
    Domains in SCOPe 2.07: d1xuba1, d1xuba2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xubA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfagapllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xubA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfagapllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl