PDB entry 1xua

View 1xua on RCSB PDB site
Description: Structure and function of the phenazine biosynthetic protein PhzF from Pseudomonas fluorescens
Class: biosynthetic protein
Keywords: phenazine biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2004-10-26, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xuaa1, d1xuaa2
  • Chain 'B':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51792 (20-297)
      • cloning artifact (19)
    Domains in SCOPe 2.07: d1xuab1, d1xuab2, d1xuab3
  • Heterogens: HHA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xuaA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuaA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xuaB (B:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuaB (B:)
    hmhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdal
    iriftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdq
    piptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnf
    hdmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqg
    veigrpslmfakaegraeqltrvevsgngvtfgrgtivl