PDB entry 1xu8

View 1xu8 on RCSB PDB site
Description: The 2.8 A structure of a tumour suppressing serpin
Class: signaling protein
Keywords: maspin, serpin, tumor suppressor, SERPINB5, SIGNALING PROTEIN
Deposited on 2004-10-25, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maspin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36952 (5-379)
      • cloning artifact (4)
      • see remark 999 (70)
    Domains in SCOPe 2.07: d1xu8a1, d1xu8a2
  • Chain 'B':
    Compound: Maspin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36952 (5-379)
      • cloning artifact (4)
      • see remark 999 (70)
    Domains in SCOPe 2.07: d1xu8b1, d1xu8b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xu8A (A:)
    mgqnsmdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneig
    qvlhfenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyake
    letvdfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkf
    pesetkecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkd
    vedestglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkh
    ifsedtsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfi
    yiirhnktrniiffgkfcsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu8A (A:)
    smdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlh
    fenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletv
    dfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpese
    tkecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvede
    stglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifse
    dtsdfsgmsetkgvalsnvihkvcleitedggdhkdelnadhpfiyiirhnktrniiffg
    kfcsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xu8B (B:)
    mgqnsmdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneig
    qvlhfenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyake
    letvdfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkf
    pesetkecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkd
    vedestglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkh
    ifsedtsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfi
    yiirhnktrniiffgkfcsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu8B (B:)
    smdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlh
    fenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletv
    dfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpese
    tkecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvede
    stglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifse
    dtsdfsgmsetkgvalsnvihkvcleitedggdvpgarilqhkdelnadhpfiyiirhnk
    trniiffgkfcsp