PDB entry 1xu6

View 1xu6 on RCSB PDB site
Description: Structure of the C-terminal domain from Trypanosoma brucei Variant Surface Glycoprotein MITat1.2
Deposited on 2004-10-25, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: NMR60
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xu6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xu6A (A:)
    gshmlevltqkhkpaesqqqaaetegscnkkdqneckspckwhndaenkkctldkeeakk
    vadetakdgktgntnttgss