PDB entry 1xu2

View 1xu2 on RCSB PDB site
Description: The crystal structure of APRIL bound to BCMA
Class: CYTOKINE, HORMONE/GROWTH FACTOR receptor
Keywords: TNFSF, cytokine, CRD, receptor, jelly-roll, cysteine-rich, HORMONE-GROWTH FACTOR receptor COMPLEX
Deposited on 2004-10-25, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2a_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2b_
  • Chain 'D':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2d_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF17, BCM, BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2r_
  • Chain 'S':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF17, BCM, BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2s_
  • Chain 'T':
    Compound: Tumor necrosis factor receptor superfamily member 17
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF17, BCM, BCMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xu2t_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xu2A (A:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2A (A:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xu2B (B:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2B (B:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xu2D (D:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2D (D:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xu2R (R:)
    agqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2R (R:)
    csqneyfdsllhacipcqlrcssntppltcqrycna
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1xu2S (S:)
    agqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2S (S:)
    gqcsqneyfdsllhacipcqlrcssntppltcqrycn
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xu2T (T:)
    agqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu2T (T:)
    csqneyfdsllhacipcqlrcssntppltcqrycn