PDB entry 1xu1

View 1xu1 on RCSB PDB site
Description: The crystal structure of APRIL bound to TACI
Class: CYTOKINE, HORMONE/GROWTH FACTOR receptor
Keywords: TNFSF, cytokine, CRD, receptor, jelly-roll, cysteine-rich, HORMONE-GROWTH FACTOR receptor COMPLEX
Deposited on 2004-10-25, released 2004-11-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1a_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1b_
  • Chain 'D':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf13, APRIL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1d_
  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 13B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF13B, TACI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1r_
  • Chain 'S':
    Compound: Tumor necrosis factor receptor superfamily member 13B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF13B, TACI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1s_
  • Chain 'T':
    Compound: Tumor necrosis factor receptor superfamily member 13B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF13B, TACI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xu1t_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xu1A (A:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1A (A:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xu1B (B:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1B (B:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xu1D (D:)
    kkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfh
    dvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipra
    naklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1D (D:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xu1R (R:)
    slscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1R (R:)
    slscrkeqgkfydhllrdciscasicgqhpkqcayfce
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1xu1S (S:)
    slscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1S (S:)
    crkeqgkfydhllrdciscasicgqhpkqcayfcen
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xu1T (T:)
    slscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu1T (T:)
    crkeqgkfydhllrdciscasicgqhpkqcayfcenklr