PDB entry 1xu0

View 1xu0 on RCSB PDB site
Description: Solution structure of Xenopus leavis prion protein
Class: membrane protein
Keywords: prion, amphibian, polymorphism, glycoprotein, membrane protein
Deposited on 2004-10-25, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Xenopus laevis [TaxId:8355]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xu0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xu0A (A:)
    gsgynkqwkppksktnmksvaigaaagaiggymlgnavgrmsyqfnnpmesryyndyynq
    mpnrvyrpmyrgeeyvsedrfvrdcynmsvteyiikpaegknnselnqldttvksqiire
    mciteyrrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xu0A (A:)
    iggymlgnavgrmsyqfnnpmesryyndyynqmpnrvyrpmyrgeeyvsedrfvrdcynm
    svteyiikpaegknnselnqldttvksqiiremciteyrrgs