PDB entry 1xtz

View 1xtz on RCSB PDB site
Description: crystal structure of the s. cerevisiae d-ribose-5-phosphate isomerase: comparison with the archeal and bacterial enzymes
Deposited on 2004-10-25, released 2005-08-30
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose-5-phosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RKI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12189 (18-257)
      • expression tag (258-263)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xtzA (A:)
    maagvpkidaleslgnpledakraaayravdenlkfddhkiigigsgstvvyvaerigqy
    lhdpkfyevaskficiptgfqsrnlildnklqlgsieqypridiafdgadevdenlqlik
    gggaclfqeklvstsaktfivvadsrkkspkhlgknwrqgvpieivpssyvrvkndlleq
    lhaekvdirqggsakagpvvtdnnnfiidadfgeisdprklhreikllvgvvetglfidn
    askayfgnsdgsvevtekhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1xtzA (A:)
    edakraaayravdenlkfddhkiigigsgstvvyvaerigqylhdpkfyevaskficipt
    gfqsrnlildnklqlgsieqypridiafdgadevdenlqlikgggaclfqeklvstsakt
    fivvadsrkkspkhlgknwrqgvpieivpssyvrvkndlleqlhaekvdirqggsakagp
    vvtdnnnfiidadfgeisdprklhreikllvgvvetglfidnaskayfgnsdgsvevtek
    hhhhhh