PDB entry 1xty

View 1xty on RCSB PDB site
Description: Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase
Class: hydrolase
Keywords: mixed beta sheet, hydrolase
Deposited on 2004-10-25, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtya_
  • Chain 'B':
    Compound: Peptidyl-tRNA hydrolase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtyb_
  • Chain 'C':
    Compound: Peptidyl-tRNA hydrolase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtyc_
  • Chain 'D':
    Compound: Peptidyl-tRNA hydrolase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtyd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtyA (A:)
    mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk
    vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtyB (B:)
    mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk
    vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtyC (C:)
    mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk
    vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtyD (D:)
    mikmvivvrsdikmgkgkiaaqvahaavtlvvsiinsnnlrwkewlnewlhqgqpkiivk
    vnsldeiisrakkaetmnlpfsiiedagktqlepgtitclgigpapenlvdsitgdlkll