PDB entry 1xtx

View 1xtx on RCSB PDB site
Description: Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
Class: Isomerase
Keywords: thioredoxin fold
Deposited on 2004-10-25, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-04-25, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Humicola insolens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55059 (5-120)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1xtxa1, d1xtxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtxA (A:)
    gplgsegpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefk
    drvviakvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkyka
    a