SCOPe 2.06: Structural Classification of Proteins

PDB entry 1xtv

View 1xtv on RCSB PDB site
Description: Sulfolobus solfataricus uracil phosphoribosyltransferase with uridine 5'-monophosphate (UMP) bound to half of the subunits
Class: Transferase
Keywords: Tetramer, type 1 phosphoribosyltransferase, UMP complex
Deposited on 2004-10-24, released 2005-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtva_
Chain 'B':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvb_
Chain 'C':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvc_
Chain 'D':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvd_
Chain 'E':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtve_
Chain 'F':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvf_
Chain 'G':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvg_
Chain 'H':
Compound: Probable uracil phosphoribosyltransferase
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: UPP
Database cross-references and differences (RAF-indexed):
- Uniprot Q980Q4 (Start-215)
Domains in SCOPe 2.06: d1xtvh_
Heterogens: U5P

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xtvA (A:)
mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
skypfiylftvaidpelnnkgyilpglgdagdrafg