PDB entry 1xtu

View 1xtu on RCSB PDB site
Description: Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (UMP) and cytidine 5'-triphosphate (CTP)
Class: Transferase
Keywords: Tetramer, type 1 phosphoribosyltransferase, UMP and CTP complex
Deposited on 2004-10-24, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtua_
  • Chain 'B':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtub_
  • Chain 'C':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtuc_
  • Chain 'D':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtud_
  • Chain 'E':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtue_
  • Chain 'F':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtuf_
  • Chain 'G':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtug_
  • Chain 'H':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtuh_
  • Heterogens: U5P, CTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtuA (A:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuA (A:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xtuB (B:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuB (B:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xtuC (C:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuC (C:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xtuD (D:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuD (D:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xtuE (E:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuE (E:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xtuF (F:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuF (F:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xtuG (G:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuG (G:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xtuH (H:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtuH (H:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg