PDB entry 1xtq

View 1xtq on RCSB PDB site
Description: Structure of small GTPase human Rheb in complex with GDP
Class: signaling protein
Keywords: beta saddle, P-loop, SIGNALING PROTEIN
Deposited on 2004-10-24, released 2005-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rheb
    Species: Homo sapiens [TaxId:9606]
    Gene: Rheb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15382 (Start-168)
      • expression tag (169-170)
    Domains in SCOPe 2.05: d1xtqa1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xtqA (A:)
mpqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvd
tagqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnk
kdlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaeklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1xtqA (A:)
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekle