PDB entry 1xtp

View 1xtp on RCSB PDB site
Description: Structural Analysis of Leishmania major LMAJ004091AAA, a SAM-dependent methyltransferase of the DUF858/Pfam05891 family
Class: Structural genomics, transferase
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, SAM-DEPENDENT METHYLTRANSFERASE, Structural Genomics of Pathogenic Protozoa Consortium, transferase
Deposited on 2004-10-22, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lmaj004091aaa
    Species: Leishmania major [TaxId:347515]
    Gene: LmjF30.0810
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xtpa1, d1xtpa2
  • Heterogens: SAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtpA (A:)
    gpgsmpskeassrnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtv
    patvsgvlggmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattd
    llepvkhmleeakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkff
    khcqqaltpngyiffkencstgdrflvdkedssltrsdihykrlfnesgvrvvkeafqee
    wptdlfplkmyalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtpA (A:)
    gpgsmprnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatvsg
    vlggmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattdllepvk
    hmleeakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkffkhcqqa
    ltpngyiffkencsdrflvdkedssltrsdihykrlfnesgvrvvkeafqeewptdlfpl
    kmyalk